PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676732644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family MYB
Protein Properties Length: 522aa    MW: 58094.8 Da    PI: 5.9726
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676732644genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-163481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed++l+d+v+q+G g+W+++ ++  + R++k+c++rw ++l
        676732644 34 KGPWSSAEDDILIDYVNQHGEGNWNAVQKHTSLFRCGKSCRLRWANHL 81
                     79******************************************9986 PP

2Myb_DNA-binding41.72.8e-1387136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.....TTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg.....kgRtlkqcksrwqk 46 
                      +g++T +E+el+v++++++G++ W++ a++        gRt++++k++w++
        676732644  87 KGAFTLQEEELIVELHAKMGNR-WARMAAHRVfpsqlPGRTDNEIKNYWNT 136
                      799*******************.*******9999***************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.372981IPR017930Myb domain
SuperFamilySSF466892.81E-2632134IPR009057Homeodomain-like
SMARTSM007177.4E-143383IPR001005SANT/Myb domain
PfamPF002492.8E-143481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-233588IPR009057Homeodomain-like
CDDcd001671.03E-103681No hitNo description
PROSITE profilePS5129420.72782142IPR017930Myb domain
SMARTSM007179.8E-1386140IPR001005SANT/Myb domain
PfamPF002492.0E-1187136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2289141IPR009057Homeodomain-like
CDDcd001671.58E-989136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MSYSSTESDH NESPFTDDGS DCRRSRWEAN ALKKGPWSSA EDDILIDYVN QHGEGNWNAV  60
QKHTSLFRCG KSCRLRWANH LRPNLKKGAF TLQEEELIVE LHAKMGNRWA RMAAHRVFPS  120
QLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEMHVQVLEW SQEYTKSRIL GRERSHQDFL  180
QLGSCESDVF FDSLNFVPDV VPAASDLACK LLGDGTSSPR YGNFMPSSKR LRGSESLYPG  240
CSSTLKEDIP SPEHFQNTAA QQKSSTTCSF SVPCDVDHPS YGKQHVPVMI PDSHTLTDGL  300
VPTSNPTSGE VKLELPSFQY SEATSDQWKD SASPPHSELL DPFDAYIQSP PQTGRKESDF  360
FSSYNTGLLD MLLLEANYRN NSTKNSLYKS CASPTPSPDV GEFNVSQIKS EEFGNSLKSL  420
VHSGISIPTQ HNADGIPLRQ REKERKPVLD ITRPDVWLAS SWLDHGLGIV KETGSMSDAL  480
AVLLGDDVGN DYVQMSIGAS SGVVGSCAWS NMPPVCQMTE LP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27321415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399071.10.0hypothetical protein EUTSA_v10013329mg
TrEMBLV4LA660.0V4LA66_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.6__546__AT5G06100.30.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.30.0myb domain protein 33